IGF-1 LR3

IGF-1 LR3 1mg Vial – Long-Acting Insulin-Like Growth Factor-1 Research Peptide (Research Use Only)

IGF-1 LR3 (Long R3 IGF-1) is an 83-amino-acid recombinant analog of human IGF-1 with two key modifications: an arginine substitution at position 3 and a 13-amino-acid extension at the N-terminus. These changes dramatically extend its half-life to 20–30 hours and make it up to three times more potent than native IGF-1 by reducing binding to inhibitory proteins. It is the gold-standard long-acting IGF-1 for advanced muscle, cartilage, and recovery research.

Each sterile vial contains a full 1mg of lyophilized IGF-1 LR3 at ≥99% purity (independently verified by HPLC and mass spectrometry), delivering precise, reproducible anabolic signaling in cell culture and in-vitro studies.

Key research applications:

• Muscle hypertrophy and hyperplasia models
• Myoblast proliferation and satellite cell activation
• Cartilage regeneration and joint repair studies
• Protein synthesis and nutrient partitioning pathways
• Anti-catabolic effects during caloric restriction experiments

Product Specifications:

• Strength: 1mg per vial
• Form: White lyophilized powder in sealed glass vial
• Purity: ≥99% (third-party tested, full COA included)
• Sequence: MFPAMPLSSLFVNGPRTLCGAELVDALQFVCGDRGFYFNKPTGYGSSSRRAPQTGIVDECCFRSCDLRRLEMYCAPLKPAKSA (R3 substitution + 13-aa extension)
• Molecular Weight: 9111.5 g/mol
• Storage: Store at -20°C; stable for 36+ months

Strictly sold for licensed laboratory, scientific, and in-vitro research purposes only. Not for human or veterinary consumption.

Perfect for universities, muscle biology labs, tissue engineering groups, and researchers studying prolonged IGF-1 receptor activation.

Order your IGF-1 LR3 1mg research vial today: third-party tested, cold-chain shipped, discreetly packaged. Limited stock available.